PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn120641
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 148aa    MW: 16654.3 Da    PI: 7.6698
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn120641genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26061.52.2e-19651401489
      DUF260  14 kdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                 ++C + p + a  +++fa+vhk+FGasnv+kll ++p ++r da+ +++yeA+ar+rd  y  v++i++lqqql+ 
  Achn120641  65 DKCHIEPSLEALGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTICYEAQARLRDLFYVFVAHIFALQQQLDA 140
                 68***********************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508918.99451147IPR004883Lateral organ boundaries, LOB
PfamPF031952.7E-1965140IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MGKAIQKQNH NSEAHGFWVC LEWGKGRPLI LEFQKVEDDR NKKGQKRVSR NGYVLLLEDN  60
VPDVDKCHIE PSLEALGAAH FAAVHKVFGA SNVSKLLLHI PVHKRLDAVV TICYEAQARL  120
RDLFYVFVAH IFALQQQLDA IGIIEME*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006445237.12e-31hypothetical protein CICLE_v10021992mg
RefseqXP_006491458.12e-31PREDICTED: LOB domain-containing protein 18
RefseqXP_008467063.12e-31PREDICTED: LOB domain-containing protein 18-like
SwissprotO221318e-30LBD18_ARATH; LOB domain-containing protein 18
TrEMBLM1AYU86e-32M1AYU8_SOLTU; Uncharacterized protein
TrEMBLA0A067HD702e-31A0A067HD70_CITSI; Uncharacterized protein
TrEMBLV4TY072e-31V4TY07_9R
STRINGPGSC0003DMT4000332532e-31(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45420.14e-31LOB domain-containing protein 18